<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9191 9191-30915 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G, K219D K103N, Y181I   E40F, S68G, V118VI, K122E, D123N, I135T, I142IV, D177E, G196E, T200TI  
>9191-30915| codons 38-247
CTFLEKEGKISKIGPENPYNTPVFAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIIQYVDDLYVGSDLEIEQHRIKIEELRQHLWRWGFYTP
DDKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V L10F, L24I E34Q, M36V, R41K, K55R, I62V, L63P, I64V  
>9191-30915| codons 4-99
TLWQRPFVTIKIGGQLKEALIDTGADDTVLQEVNLPGKWKPKIIGGIGGFVRVRQYDQVP
VEICGHKAIGTVVVGPTPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006