<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9182 9182-30901 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, I84V, L90M L10F, L33F, Q58E, T74P T12K, I13V, I15V, K20T, E35G, M36L, R41K, I62V, L63Q, I64V, A71V, L89M, I93L  
>9182-30901| codons 4-99
TLWQRPFVKVKVGGQLTEALLDTGADDTVFEGLNLPGKWKPKIIGGIGGFAKVREYDQVQ
VEICGHKVIGPVLVGPTPVNVIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M, M184V A62V, V75I, F77L, F116Y, K219E K103N V108I S68G, T69I, V111I, V118VI, D123E, Q174QR, E203K, F214L, H221HY  
>9182-30901| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKRKDGIRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDIGDAYYSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKRNPDIVIYQYVDDLYVGSDLEIGQHRTKIKELRQHLLRWGLTTP
DEKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006