<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9185 9185-30901 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, V82A   L10I, I13V, I15V, K20R, M36I, K43R, L63P, I64V, A71V  
>9185-30901| codons 4-99
TLWQRPIVTVKVGGQLREALLDTGADDTILEEINLPGRWRPKLIGGIGGFIKVRQYDQIP
VEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, L210W, T215Y K219KE K103N V108I, K238KN V60VI, V118VI, K122E, I135T, T139TI, K166R, I202IV, R211K, E224ED, L228LH, V245E I142LMPT
>9185-30901| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSTNNEIPGTRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTP
DEKHQKDPPFHWMGYELHPDNWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006