<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9184 9184-30901 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, K43T, F53L, N83D L10I, I13V, K20R, M36L, N37T, K55KR, R57RK, D60DE, I62V, L63P, I64V, L89LM  
>9184-30901| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVFEELTLPGRWTPKLIGGIGGLVRVKQYEQVP
VEICGHKAIGTVLVGPTPADIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, Q151M, M184MV, L210W, T215Y F116Y     V60I, K101Q, D121Y, K122E, D123E, S162C, I167V, Q174R, D177E, T200A, I202IV, H208Y, R211K, V245T N137NH
>9184-30901| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYYSVPLYEEFRKYTAFTIPSINHETPGIRYQYNVLPMGWKGSP
AIFQCSMTKVLEPFRKRNPEIVIYQYVDDLYVGSDLEIGQHRAKVEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006