<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9181 9181-30901 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82S, L90M K43T L10V, T12TP, L19LI, K20R, E35D, M36I, R57RK, I62V, L63P, A71V, Q92K, I93L, C95F  
>9181-30901| codons 4-99
TLWQRPVVPIKIGGQIREALLDTGADDTVLEDINLPGRWTPKLIGGIGGFVKVKQYDQVP
IEICGHKVIGTVLVGPTPSNIIGRNLMTKLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69TADN, L210W, T215Y V75M, K219R K101E, G190A V108I, F227L K43Q, E44D, V60I, V90I, V118I, K122E, I135T, T139K, T200I, E203K, H208Y, R211K, K223E, L228H  
>9181-30901| codons 38-247
CTELEQDGKISKIGPENPYNTPIFAIKKKNSNKWRKLMDFRELNKRTQDFWEIQLGIPHP
AGLEKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVASDLEIGQHRIKIKELRQYLWKWGFYTP
DRKHQEEPPLHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006