<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9352 9352-30924 Brazil 2003 HIV1 U Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, L210W, T215Y K219N Y188L   K43E, V60I, E79ED, V118I, K122E, D123E, S162C, D177E, T200A, R211K, V245K  
>9352-30924| codons 38-247
CTELEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRDLNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEIVIYQYMDDLLVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84V, L90M F53L L10V, I15V, K20R, E35D, M36I, N37NS, R41K, R57K, D60E, Q61D, I62V, L63P, A71V, I85V  
>9352-30924| codons 4-99
TLWQRPVVTIKVGGQLREALLDTGADDTVLEDISLPGKWKPKIIGGIGGLIKVKQYEDVP
IEICGHKVIGTVLVGPTPANVVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006