<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9275 9275-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, I84V, L90M Q58E L10I, K20R, E35D, M36I, I62V, L63P, A71V, I72V, I85V, I93L  
>9275-30923| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVREYDQVP
IEICGHKVVGTVLVGPTPFNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K103N   D123E, I135T, I142V, S162C, Q197E, E204Q, Q207D, V245K  
>9275-30923| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGEHRTKIEQLRDHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006