<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9270 9270-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A, L90M K43T L10I, I13V, I15V, Q18H, K20I, M36I, N37D, I62V, L63P, A71L, I93L  
>9270-30918| codons 4-99
TLWQRPIVTVKVGGHLIEALLDTGADDTVLEEIDLPGRWTPKLIVGIGGFSKVRQYDQVP
IEICGHKLIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K70KQ K103N   T39TA, E40F, K43E, K122E, D123E, I135T, E138Q, S162C, I167V, I178L, G196E, Q207E, H208Y, R211K, D237E  
>9270-30918| codons 38-247
CAFLEEEGKISKIGPENPYNTPVFAIKKKNSTQWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSP
AIFQCSMTKVLEPFRKQNPDLVIYQYVDDLYVGSDLEIEQHRTKIEELREYLWKWGFYTP
DKKHQKEPPFLWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006