<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9219 9219-30915 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215I K103N, G190A   D121Y, K122E, I178L, E204Q, Q207E, R211K, F214L, V245KM  
>9219-30915| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYMDDLYVASDLEIGQHRTKIEQLREHLLKWGLITP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14M, L19Q, N37C, D60E, Q61D, I64V, V77I  
>9219-30915| codons 4-99
TLWQRPLVTIMIGGQQKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYEDIL
VEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006