<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9268 9268-30915 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y V75M, F77L Y188L, G190GA   K43Q, K49R, V118I, K122E, I135T, T139TI, G141GA, V179VI, V189I, R211K, L228H, V245E  
>9268-30915| codons 38-247
CTELEQEGKISRIGPENPYNTPVFAIKKKDSTKWRKLMDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNEIPAIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLLIASDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, G73C L10I, I15V, E35D, M36I, K55R, D60E, I62V, L63P, I72L  
>9268-30915| codons 4-99
TLWQRPIVTIKVGGQLKEALIDTGADDTVLEDINLPGRWKPKIIGGIGGFVRVRQYEQVP
IEICGHKALCTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006