<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9217 9217-30908 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46FL, I54V, V82A, L90M L33I L10I, I15V, K20R, E35D, M36I, N37E, R41K, K43R, R57K, Q61N, L63A, A71V, Q92K, I93L  
>9217-30908| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVIEDIELPGKWRPKLIGGIGGFVKVKQYDNIA
IEICGHKVIGTVLVGPTPANIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     K49KR, I135V, S162Y, E169D, K173A, Q174K, I178L, V179I, E203D, Q207E, H208Y, R211K, D218E, L228H, Q242QH  
>9217-30908| codons 38-244
CTELEKEGKISRIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILDPFRAKNPDLIIYQYVDDLYVGSDLEIGQHRTKIDELREYLLKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVHPI

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006