<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9218 9218-30908 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54AT, V82A L10F, L24I, L33F, K43T G16A, L19LV, E34Q, K55KR, L63P, A71V, I72V, Q92K, I93L  
>9218-30908| codons 4-99
TLWQRPFVTIKIAGQVKEALIDTGADDTVFQEMNLPGRWTPKIIGGIGGFTRVRQYDQIP
IEICGHKVVGTVLVGPTPANIIGRNLLTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M, K219R K103N   K43N, E44D, V90I, I94L, V118I, K122E, I135L, I142V, G196E, T200TA, E203D, H208Y, R211K, H221Y, V245K  
>9218-30908| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEIQLGLPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRAKIDELRQYLWKWGFYTP
DRKYQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006