<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9216 9216-30908 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, I84IV, L90M Q58E L10I, T12TA, L19LV, D60E, I62V, L63P, A71AT, V77I, I93L  
>9216-30908| codons 4-99
TLWQRPIVAIKIGGQVKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVREYEQVP
IEICGHKTIGTVLIGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, T69TADN, M184MV, T215Y   Y181YC   V118VI, K122E, D123N, I135T, I142IV, D177E, I178M, T200A, R211K, V245T  
>9216-30908| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVICQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006