<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9039 9039-30901 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M L10F, V11IL, G73S, L89V K20I, E34Q, E35ED, M36MI, N37S, L63P, H69K, A71V, I85V, I93L  
>9039-30901| codons 4-99
TLWQRPFLTIKIGGQLIEALLDTGADDTVLQDISLPGRWKPKIVGGIGGFMKVRQYDQIP
IEICGKKVISTVLVGPTPVNVVGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75L, F77L K103N   V118I, K122E, I135T, D177DN, Q197E, T200K, R211H  
>9039-30901| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLLDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPNIVIYQYVDDLYVGSDLEIGEHRKKIEELRQHLWHWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006