<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9038 9038-30901 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K103S, G190A   K101Q, K122E, I135IV, S162C, I178M, D192N, T200A, E203ED, Q207E, L228H, V245E  
>9038-30901| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDMVIYQYMDDLYVASNLEIGQHRAKIDELREHLLRWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, G73S L10I, G16A, L24F, K55R, R57K, D60E, I62V, L63P, A71V, I72L  
>9038-30901| codons 4-99
TLWQRPIVTIKIAGQLKEALFDTGADDTVFEEMNLPGRWKPKLIGGIGGFVRVKQYEQVP
IEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006