<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9030 9030-30825 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Y115F, Q151M, M184V, T215F V75I, F77L, F116NY, K219Q K101E, Y181C, G190A V108I V106VI, V118I, I135T, Q174E, E203D, R211K, F214L, L228H, V245T  
>9030-30825| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLEKKKSITILDVGDAFYSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKENPDIVICQYVDDLYVASDLEIGQHRTKIDELRQHLLKWGLFTP
DQKHQKEPPFHWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V L24I, L33F, K43KT L10I, I13IV, I15V, L19Q, K20R, E35D, M36I, N37E, R41K, K55N, R57K, I62V, I64V, E65D, A71V, Q92K  
>9030-30825| codons 4-99
TLWQRPIVTVKVGGQQREALIDTGADDTIFEDIELPGKWTPKIVGGIGGFLNVKQYDQVL
VDICGHKVIGTVLVGPTPVNVIGRNLLTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006