<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9027 9027-30825 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y181V, G190S   T69H, K102Q, K122E, D123E, I135T, S162C, V245K  
>9027-30825| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSHRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIVQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, V82A, L90M L89V L10S, I15V, G16A, K20R, E35D, M36I, N37D, R57K, L63P, A71V, I93L G73E
>9027-30825| codons 4-99
TLWQRPSVTIKVAGQLREALLDTGADDTILEDIDLPGRWKPKMVGGIGGFMKVKQYDQIP
IEICGHKVIETVLVGPTPANIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006