<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9212 9212-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Q151M, T215HY A62V, V75I, F77L, F116Y, K219E Y181C, G190A   T69N, K101Q, V179I, I202IV, E203Q, Q207E, L228H  
>9212-30929| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKNSNKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYMDDLYVASDLEIGQHRTKVQELREHLLRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82F, L90M L33I, Q58E L10I, E35D, M36I, N37D, I62V, L63V, I64V, A71V, I93L  
>9212-30929| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVIEDIDLPGRWKPKIIGGIGGFVKVREYDQVV
VEICGHKVIGTVVVGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006