<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9210 9210-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K101E, Y181C, G190A   D123E, I135V, I142V, D177E, E203D, R211K, L228R, V245I  
>9210-30929| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVASDLEIGQHRTKIDELRQHLLKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIILP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, I62V, L63P, I64L  
>9210-30929| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYDQVP
LEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006