<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9209 9209-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DGNS, K70KR, L74V K219HN G190E   A98S, K101KR, I135T, T200A, R211K, F214FL, V245E  
>9209-30929| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKSSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
SGLRKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVESDLEIGQHRAKIEELRQHLLKWGLTTP
DNKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19LF, E35D, R57RK, Q61QE, I62IV, L63P  
>9209-30929| codons 4-99
TLWQRPLVTIKIGGQFKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYDEVP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006