<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9207 9207-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L L10V, I15V, G16A, K20R, E35ED, M36I, N37D, L63P, A71T, I72V, I93L  
>9207-30922| codons 4-99
TLWQRPVVTIKVAGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGLVKVRQYDQIP
IEICGHKTVGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215Y   K103N V108VI T39TA, K43KE, K102KR, V118I, K122E, I135T, I142V, S162A, I178IM, G196GE, E203EK, Q207E, R211RK, L228LH  
>9207-30922| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006