<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9065 9065-30825 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   Y181CFGV   E44D, K49R, K122E, V148VG, V179I, Q207E, R211K, D218E, K223KQ, L228R, V245M  
>9065-30825| codons 38-247
CTELEKDGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNGLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIVQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
EKKHQQEPPFRWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, G73T L24LS, L63P, I64V, A71V, I72L, V77VI, I85V  
>9065-30825| codons 4-99
TLWQRPFVTIKIGGQLKEALSDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYDQIP
VEICGHKVLTTVLIGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006