<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9066 9066-30825 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y A62V K103NS K238T K43E, E44A, I94L, V118I, K122E, D123S, I135T, E203K, Q207DE, H208Y, R211K, K223Q, L228R N54I
>9066-30825| codons 38-247
CTELEEAGKISKIGPEIPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGLPHP
AGLKKSKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTP
DKKHQQEPPFRWMGYELHPDTWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L76V, I84V, L90M L10F I13V, I15V, Q18H, K20I, E34K, E35D, M36I, N37D, D60E, L63P, A71V  
>9066-30825| codons 4-99
TLWQRPFVTVKVGGHLIEALLDTGADDTVLKDIDLPGRWKPKMIGGIGGFVKVRQYEQIP
IEICGHKVIGTVVVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006