<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9067 9067-30825 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54L, I84V, L90M L33F, G73S L10I, I13IV, I15V, R57K, L63P, A71V, I72V, Q92QH  
>9067-30825| codons 4-99
TLWQRPIVTVKVGGQLKEALLDTGADDTIFEEMNLPGRWKPKMVGGIGGFLKVKQYDQIP
IEICGHKVVSTVLVGPTPVNVIGRNLMTHIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F A62V, K219Q   A98AG K122E, I135T, I202V, R211K T69Y, I159IR
>9067-30825| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKNSYRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
ARFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006