<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9062 9062-30820 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54IL, L76V, I84V   L10V, I13V, I15V, G17E, Q18H, K20L, E35D, M36I, F53Y, D60DE, I62V, L63P, A71T, I72T, L89I, I93L  
>9062-30820| codons 4-99
TLWQRPVVTVKVGEHLLEALLDTGADDTVLEDINLPGRWKPKIVGGIGGYLKVRQYEQVP
IEICGHKTTGTVVVGPTPVNVIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y V75VL G190S K238N I135T, K166R, T200A, L228N, V245T  
>9062-30820| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLLDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYMDDLYVSSDLEIGQHRAKIEELRQHLWRWGFYTP
DKKHQKEPPFNWMGYELHPDNWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006