<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9061 9061-30820 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82C, I84V L10F, L24I, L33F L63P, A71I, I72T, P79N, T91S, I93L  
>9061-30820| codons 4-99
TLWQRPFVTIKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYDQIP
IEICGHKITGTVLVGNTPCNVIGRNLLSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219Q     E40F, K43E, V111I, K122E, I135T, E138A, S162A, K173N, H208Y, R211K  
>9061-30820| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDIGDAYFSVPLDEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRNQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006