<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9506 9506-30930 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M G73GS L10I, I15V, K20R, E35D, M36I, N37D, R41K, R57K, Q61N, I62V, L63P, C67F, H69HR  
>9506-30930| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVKQYDNVP
IEIFGRKAISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L K70KT, T215C K103N, Y188C   T39A, E44ED, S68G, K102R, K122E, D123DN, I135V, V179VI, T200TA, I202V, E224ED, L228H, V245T L210D
>9506-30930| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKDGTTWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLCVGSDLEIGQHRAKVEELRQHLDRWGFCTP
DKKHQKDPPFHWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006