<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9289 9289-30930 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K101E, Y181C, G190S   T39L, K49R, V60I, T69TN, S162H, E169D, K173T, Q174K, G196E, Q207E, L228H, V245Q  
>9289-30930| codons 38-247
CLEMEKEGKISRIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQHSMTKILDPFRTKNPDIVICQYMDDLYVSSDLEIEQHRTKIEELREHLLRWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84IV L24I, L33LF L10I, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63LP, A71V, L89M, Q92K, I93L  
>9289-30930| codons 4-99
TLWQRPIVTIKVGGQLREALIDTGADDTVFEDINLPGKWKPKLIGGIGGFVKVKQYDNIP
IEICGHKVIGTVLVGPTPANVIGRNMLTKLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006