<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9376 9376-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N M46MV, N88D I13IV, G16E, P39S, L63P, A71V, V77VI G49GR
>9376-30929| codons 4-99
TLWQRPLVTVKIEGQLKEALLDTGADNTVLEEMNLSGRWKPKVIGRIGGFIKVRQYDQIP
IEICGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69DN, K70R   K103N, Y181C   T39A, I135T, S162C, G196E, L228R, V245L  
>9376-30929| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFRWMGYELHPDKWTVQPILLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006