<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9324 9324-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10V, K14EQ, I15V, L19IT, K20R, E35D, M36I, R41K, R57K, Q61N, L63V, E65D, H69Y, I72T, L89M  
>9324-30929| codons 4-99
TLWQRPVVTIQVGGQTREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYDNIV
IDICGYKATGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R K219Q K103KN P225PH, K238KT V60I, V118VI, K122E, I135IT, E169D, K173KR, F214L, L228LHQ, P243PS, V245K  
>9324-30929| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRRQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTP
DQKHQKEHPFQWMGYELHPDTWTVQSIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006