<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9337 9337-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75M K103NS   K101Q, V118VI, D121H, K122E, I135K, K166R, D177E, I202IV, H221Y, V245M  
>9337-30922| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLQKSKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A   L10I, K14R, I15V, N37E, K43R, R57K, I62V, L63P, A71V, I93L  
>9337-30922| codons 4-99
TLWQRPIVTIRVGGQLKEALLDTGADDTVLEEMELPGRWRPKIIGGIGGFVKVKQYDQVP
IEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006