<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9310 9310-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L33F, Q58QE, G73S L24F, N37D, L63P, A71V, I72R, V77I, I93L  
>9310-30923| codons 4-99
TLWQRPLVTIKIGGQLKEALFDTGADDTVFEEMDLPGRWKPKIIGGIGGFIKVREYDQIP
IEICGHKVRSTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W T215C Y188L V179E V106I, K122E, I142V, K173R, D177E, I178M, T200I, Q207N, R211K, V245N  
>9310-30923| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRRQNPEMEIYQYVDDLLVGSDLEIGQHRIKIEELRNHLWKWGFCTP
DKKHQKEPPFLWMGYELHPDKWTVQPINLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006