<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9176 9176-30911 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, I54V, V82A L24I, L33LI, N88D I13IV, K20R, E35D, M36I, R41K, I62V, L63P, A71V, I72IT, V77VI  
>9176-30911| codons 4-99
TLWQRPLVTVKIGGQLREALIDTGADNTVIEDINLPGKWKPKLIGGIGGFVKVRQYDQVP
IEICGHKVTGTVLIGPTPANIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y       S48T, K49R, K102Q, K122E, I135T, S162C, R211RT, V245K  
>9176-30911| codons 38-247
CTEMEKEGKITRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLTWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006