<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9192 9192-30915 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, R41K, R57K, Q61N, H69Y, I72T  
>9192-30915| codons 4-99
TLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNIL
IEICGYKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V A62V, V75I, K219Q     K122E, I135V, S162C, E169ED, K173A, Q174K, I178IL, Q197E, T200TA, Q207E, R211K, D218E, V245Q L109LP, L193LS
>9192-30915| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVPDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRAKNPDLVIYQYVDDLYVGSDSEIGEHRAKIEELREHLLKWGFTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006