<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9351 9351-30924 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10IV, I15V, L19I, K20M, M36I, Q61H, L63P, H69Q, A71T, I72E  
>9351-30924| codons 4-99
TLWQRPVVTIKVGGQIMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYDHIP
IEICGQKTEGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215F       K122E, I142V, Q174R, D177E, I178L, G196D, T200A, E203K, Q207E, R211K  
>9351-30924| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPELVIYQYMDDLYVGSDLEIDQHRAKIKELREHLLKWGFFTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006