<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9213 9213-30908 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67S, K219E K101E, Y181C, G190S   T39TA, T69N, K122E, T200A, R211A, K223KQ, L228H, V245T  
>9213-30908| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKSSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVSSDLEIGQHRAKIEELRQHLLAWGFFTP
DEKHQQEPPFHWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54T, V82A, L90M L33F, G48I, F53L L10V, T12TI, I15V, G16A, K20R, E34EQ, E35D, M36I, N37D, R41K, R57K, I62V, L63P, A71I, I72V, L89I, I93L  
>9213-30908| codons 4-99
TLWQRPVVIIKVAGQLREALLDTGADDTVFQDIDLPGKWKPKMIIGIGGLTKVKQYDQVP
IEICGHKIVGTVLVGPTPANIIGRNIMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006