<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7207 7207-30911 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67~, Y115F, Q151M, L210W, T215Y A62V, T69G, V75I, F116Y, K219E K103N, Y181C, G190A V179F P4T, E6D, K122E, I142V, S162C, S163SC, I167IV, R172K, I202V, Q207E, R211K, L228R, V245E, A272P, P294Q, K366KR, T386I, K390R  
>7207-30911| codons 1-399
PISTIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKRK~SGKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQCCMTKVLEPFKKQNPDIFI
CQYMDDLYVASDLEIGQHRTKVEELREHLWKWGFYTPDEKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIQLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I, K43T, G73T L10I, I13M, I15V, G16E, K20I, E35D, M36I, I62V, L63H, C67Y, A71V, I72V  
>7207-30911| codons 1-99
PQITLWQRPIVTMKVEGQLIEALIDTGADDTVLEDINLPGRWTPKMIGGIGGFVKVRQYD
QVHIEIYGHKVVTTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006