<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7203 7203-30814 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82T L10F, L24I, G73GS I13V, I15V, K20T, N37D, I62V, L63P, A71V, T74S, V77I  
>7203-30814| codons 1-99
PQITLWQRPFVTVKVGGQLTEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVISSVLIGPTPTNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219H   V108VI, F227FL T39TK, K43Q, K49KR, V60VI, V90VI, K122P, I135T, I178M, E203V, D218E, V245VE, T286A, P294Q, D324DE, I326IM, Y342YF, G359GS, K366R, T386I, K390R  
>7203-30814| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKEMEQEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIVELRQHLLRWGFTTPEHKHQKEPPLLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIQLTEEAE
LELAENREILKEPVHGVYYDPSKELMAEIQKQGQGQWTYQIFQEPFKNLKTGKYARMRSA
HTNDVRQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006