<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7178 7178-30827 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, K14R, N37NS, L63P, A71T, V77I  
>7178-30827| codons 1-99
PQITLWQRPLVAVRIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215TI     S68SG, D123E, I135IT, S162C, K166KR, I178M, T200TA, R211RK, A272P, T286A, E297K, V317A, Q334E, P345T, G359S, A360S, K390R  
>7178-30827| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFITPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGEGQWTYQIYQETFKNLKTGKYARMRSS
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006