<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7175 7175-30806 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A   L10I, I13V, G16E, K20R, M36I, L63C, L89I, I93IL  
>7175-30806| codons 1-99
PQITLWQRPIVTVKIEGQLREALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QICIEICGHKAIGTVVVGPTPANIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, M184V, T215TNSY D67G, K219Q     E28A, S68G, K122E, D123DN, D177E, I178M, K277R, T286A, E297A, G335GS, R358K, K390KR, A400AT  
>7175-30806| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGGTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQSQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWET

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006