<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7173 7173-30707 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       P4PS, K20R, V35VIM, K43KQ, E44ED, A98S, F171Y, G196E, T200A, R211T, M357T, G359S, A376C  
>7173-30707| codons 1-399
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLTWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRSA
HTNDVKQLTEAVQKICTESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54IMV, V82A, I84V L33F, Q58E L10I, N37Y, I62V, L63P, G68E, H69R, A71V, I93L  
>7173-30707| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMYLPGRWKPKMIVGIGGFVKVREYD
QVPIEICERKVIGTVLVGPTPANVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006