<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7165 7165-30611 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48A, I54V, V82A   L10R, T12TP, K20R, E35D, M36I, N37ND, L63P, I64V, A71V, V77I, T91A, Q92QK, I93L  
>7165-30611| codons 1-99
PQITLWQRPRVPIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIAGIGGFVKVRQYD
QIPVEICGHKVIGTVLIGPTPANIIGRNLLAKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KR     V35M, K43E, E44A, K101Q, V118I, I135V, V179I, R211K, Y271F, E297K, H315Y, V317VA, D324E, G333E, Q334H, G359S, A371V, T377L  
>7165-30611| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIFAGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVYGAYYDPSKELIAEIQKQEHGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKIALESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006