<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7157 7157-30604 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, N37C, I62V, L63C, V77I  
>7157-30604| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QVCIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       E44ED, V118VI, D123DE, T200A, E203K, H208Y, R211K, K223E, L228R, K249Q, S251ST, A288S, V292I, E297K, S322T, I329L, A360V, A376T  
>7157-30604| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIKELRQYLWKWGFYTPDKKHQEEPPFRWMGYELHPDKWT
VQPIVLPEQDTWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEIIPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGV
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006