<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7151 7151-30825 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215DY   K103N V108I V35L, D123E, I135L, Q174N, D177E, V179I, G196GR, T200I, I257IL, A272P, E297A, Q334G, A371T, A376T, T386M  
>7151-30825| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKNNPEIII
YQYMDDLYVGSDLEIRQHRIKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGGGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTETVQKITTESIVIWGKMPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M F53L, N88D I15IV, L19V, L63P, C67W, I93L C95GV
>7151-30825| codons 1-99
PQITLWQRPLVTIKVGGQVKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGLIKVRQYD
QIPIEIWGHKAIGTVLVGPTPVNIIGRDLMTQLGVTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006