<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7141 7141-30731 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, V82A L10F, L33I, N88D I13V, K20T, M36I, L63P, I64V, V75I  
>7141-30731| codons 1-99
PQITLWQRPFVTVKIGGQLTEALLDTGADNTVIEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTILVGPTPANIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103N   T39A, S105SA, K122E, I135T, S162C, R211K, L228R, A272P, R358K, G359GS, T377M, K390R  
>7141-30731| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKAVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKSA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006