<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7140 7140-30730 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82T, L90M   L10V, I15V, L19I, K20R, E35D, M36I, K55R, L63P, H69Q, A71V, Q92K, I93M, C95F  
>7140-30730| codons 1-99
PQITLWQRPVVTIKVGGQIREALLDTGADDTVLEDINLPGRWKPKIIGGIGGFARVRQYD
QIPIEICGQKVIGTVLVGPTPTNIIGRNLMTKMGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_SG, L210W, T215Y A62V     V118I, K122E, I135V, T139A, S162C, R211K, L228H, A272P, T286A, E291D, E297K, R356K, M357T, V365VI, K366R, E399K  
>7140-30730| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNEAPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKTRGA
HTNDIRQLTEAVQKIATESIVIWGKTPKFKLPIQKETWK

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006