<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7139 7139-30730 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46IV, I47V, I54L, V82VA, L90M L33F, K43T L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V, I85V, Q92K  
>7139-30730| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTIFEDIDLPGRWTPKVVGGIGGFLKVRQYD
QVPIEICGHKVIGTVLVGPTPANIVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M F116Y, T215I, K219Q K101E, G190A   I2IV, P4PST, K20KR, V35T, T39A, V60I, T69N, K103KR, K122E, I135T, E169D, P170L, L228LR, A272S, T286A, V317VA, I326V, M357T, T386I V111VIM
>7139-30730| codons 1-399
PVSTIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKRKSVTVLDMGDAYYSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILDLFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFITPDQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006