<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7091 7091-30829 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33F, G73S K55R, I62V, L63P, A71T, I72T, I93IL  
>7091-30829| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVRVRQYD
QVPIEICGHKTTSTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y188L   E6EK, S48E, V118I, K122E, K166R, T200A, Q207E, H208Y, R211K, K223T, L228R, A272P, K277R, I293IV, M357T, K366R, K390R, K395R  
>7091-30829| codons 1-399
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRAKIEELREYLWKWGFYTPDKKHQTEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVRQLTEAVQKIATESIVIWGKTPKFRLPIQRETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006