<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7090 7090-30731 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210LW, T215Y K219Q, N348I G190S   K32E, V35K, V60I, I135T, V245M, A272P, I293V, E297EKQ, R358K, K390R  
>7090-30731| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIEALKEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVSSDLEIGQHRTKIEELRQHLWRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L76LV, I84V V11VI, L33F, L89V L10I, I13V, K14R, E34EQ, N37ND, I62IV, L63P, K70KQ, A71T, I72T, P79A, Q92R  
>7090-30731| codons 1-99
PQITLWQRPIITVRIGGQLKEALLDTGADDTVFQEMDLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHQTTGTVVVGATPVNVIGRNVLTRIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006