<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7063 7063-30708 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M L10FI, V11VI, L89V T12E, I13V, K20I, E34Q, D60E, I62IV, L63P, A71V, I72L, T91TA, Q92K  
>7063-30708| codons 1-99
PQITLWQRPIIEVKIGGQLIEALLDTGADDTVLQEMNLPGRWKPKIIGGIGGFVKVRQYE
QVPIEICGHKVLGTVVVGPTPVNVIGRNVMAKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75I, K219E K103KN, Y181C, G190A K101H, F227L K11R, K20R, V35R, K49R, I50V, K122E, I135T, P170S, D218E, K223T, L228HR, T286A, E297K, M357T, T369V, E370D, A376T  
>7063-30708| codons 1-399
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALREICTELEKEGKISRVGPENPYNTPV
FAIKKKNSTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLHKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILESFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPEEKHQTEPPLRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLVDAVQKITTESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006